Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion
As diabetes is a major cause of mortality and morbidity in epidemic rates, continuous research is being done on development of foods with anti-diabetic activity. In this study, the influence of gastrointestinal digestion of quinoa protein to release peptides with anti-diabetic potential was investigated. Quinoa protein was subjected to an in vitro simulated gastrointestinal digestion and fractionated by ultrafiltration. Gastric and gastroduodenal digests and peptide fractions were evaluated for dipeptidyl peptidase IV (DPP-IV), α-amylase and α-glucosidase inhibitory activities. Peptides released during the duodenal phase showed the highest inhibitory effects. Three novel peptides derived from 11S seed storage globulin B were identified in the most active fraction by HPLC-MS/MS. These peptides showed ability to inhibit enzymes involved in incretin degradation and digestion of dietary carbohydrates. Therefore, quinoa proteins are promising ingredients of functional foods or nutraceutical applications for the control of diabetes.
Na minha lista:
| Principais autores: | , , |
|---|---|
| Outros Autores: | |
| Formato: | artículo biblioteca |
| Publicado em: |
Elsevier
2017
|
| Assuntos: | Anti-diabetic activity, Bioactive peptides, Quinoa, Simulated gastrointestinal digestion, |
| Acesso em linha: | http://hdl.handle.net/10261/171169 http://dx.doi.org/10.13039/501100003329 |
| Tags: |
Adicionar Tag
Sem tags, seja o primeiro a adicionar uma tag!
|
| id |
dig-ictan-es-10261-171169 |
|---|---|
| record_format |
koha |
| spelling |
dig-ictan-es-10261-1711692020-12-13T09:10:22Z Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion Vilcacundo, Rubén Martínez Villaluenga, Cristina Hernández-Ledesma, Blanca Universidad Técnica de Ambato Ministerio de Economía y Competitividad (España) Anti-diabetic activity Bioactive peptides Quinoa Simulated gastrointestinal digestion As diabetes is a major cause of mortality and morbidity in epidemic rates, continuous research is being done on development of foods with anti-diabetic activity. In this study, the influence of gastrointestinal digestion of quinoa protein to release peptides with anti-diabetic potential was investigated. Quinoa protein was subjected to an in vitro simulated gastrointestinal digestion and fractionated by ultrafiltration. Gastric and gastroduodenal digests and peptide fractions were evaluated for dipeptidyl peptidase IV (DPP-IV), α-amylase and α-glucosidase inhibitory activities. Peptides released during the duodenal phase showed the highest inhibitory effects. Three novel peptides derived from 11S seed storage globulin B were identified in the most active fraction by HPLC-MS/MS. These peptides showed ability to inhibit enzymes involved in incretin degradation and digestion of dietary carbohydrates. Therefore, quinoa proteins are promising ingredients of functional foods or nutraceutical applications for the control of diabetes. This work has received financial support from Ministry of Economy and Competitiveness (MINECO, Spain) through the projects AGL2013-43247-R and AGL2015-66886-R. R.V. acknowledges Universidad Técnica de Ambato (UTA, Ecuador) for his fellowship (23-CU-P-2015). Peer Reviewed 2018-10-17T11:35:03Z 2018-10-17T11:35:03Z 2017 2018-10-17T11:35:03Z artículo http://purl.org/coar/resource_type/c_6501 doi: 10.1016/j.jff.2017.06.024 issn: 1756-4646 e-issn: 2214-9414 Journal of Functional Foods 35: 531-539 (2017) http://hdl.handle.net/10261/171169 10.1016/j.jff.2017.06.024 http://dx.doi.org/10.13039/501100003329 #PLACEHOLDER_PARENT_METADATA_VALUE# #PLACEHOLDER_PARENT_METADATA_VALUE# info:eu-repo/grantAgreement/MINECO/Plan Estatal de Investigación Científica y Técnica y de Innovación 2013-2016/AGL2013-43247-R info:eu-repo/grantAgreement/MINECO/Plan Estatal de Investigación Científica y Técnica y de Innovación 2013-2016/AGL2015-66886-R Postprint https://doi.org/10.1016/j.jff.2017.06.024 Sí open Elsevier |
| institution |
ICTAN ES |
| collection |
DSpace |
| country |
España |
| countrycode |
ES |
| component |
Bibliográfico |
| access |
En linea |
| databasecode |
dig-ictan-es |
| tag |
biblioteca |
| region |
Europa del Sur |
| libraryname |
Biblioteca del ICTAN España |
| topic |
Anti-diabetic activity Bioactive peptides Quinoa Simulated gastrointestinal digestion Anti-diabetic activity Bioactive peptides Quinoa Simulated gastrointestinal digestion |
| spellingShingle |
Anti-diabetic activity Bioactive peptides Quinoa Simulated gastrointestinal digestion Anti-diabetic activity Bioactive peptides Quinoa Simulated gastrointestinal digestion Vilcacundo, Rubén Martínez Villaluenga, Cristina Hernández-Ledesma, Blanca Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion |
| description |
As diabetes is a major cause of mortality and morbidity in epidemic rates, continuous research is being done on development of foods with anti-diabetic activity. In this study, the influence of gastrointestinal digestion of quinoa protein to release peptides with anti-diabetic potential was investigated. Quinoa protein was subjected to an in vitro simulated gastrointestinal digestion and fractionated by ultrafiltration. Gastric and gastroduodenal digests and peptide fractions were evaluated for dipeptidyl peptidase IV (DPP-IV), α-amylase and α-glucosidase inhibitory activities. Peptides released during the duodenal phase showed the highest inhibitory effects. Three novel peptides derived from 11S seed storage globulin B were identified in the most active fraction by HPLC-MS/MS. These peptides showed ability to inhibit enzymes involved in incretin degradation and digestion of dietary carbohydrates. Therefore, quinoa proteins are promising ingredients of functional foods or nutraceutical applications for the control of diabetes. |
| author2 |
Universidad Técnica de Ambato |
| author_facet |
Universidad Técnica de Ambato Vilcacundo, Rubén Martínez Villaluenga, Cristina Hernández-Ledesma, Blanca |
| format |
artículo |
| topic_facet |
Anti-diabetic activity Bioactive peptides Quinoa Simulated gastrointestinal digestion |
| author |
Vilcacundo, Rubén Martínez Villaluenga, Cristina Hernández-Ledesma, Blanca |
| author_sort |
Vilcacundo, Rubén |
| title |
Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion |
| title_short |
Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion |
| title_full |
Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion |
| title_fullStr |
Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion |
| title_full_unstemmed |
Release of dipeptidyl peptidase IV, α-amylase and α-glucosidase inhibitory peptides from quinoa (Chenopodium quinoa Willd.) during in vitro simulated gastrointestinal digestion |
| title_sort |
release of dipeptidyl peptidase iv, α-amylase and α-glucosidase inhibitory peptides from quinoa (chenopodium quinoa willd.) during in vitro simulated gastrointestinal digestion |
| publisher |
Elsevier |
| publishDate |
2017 |
| url |
http://hdl.handle.net/10261/171169 http://dx.doi.org/10.13039/501100003329 |
| work_keys_str_mv |
AT vilcacundoruben releaseofdipeptidylpeptidaseivaamylaseandaglucosidaseinhibitorypeptidesfromquinoachenopodiumquinoawilldduringinvitrosimulatedgastrointestinaldigestion AT martinezvillaluengacristina releaseofdipeptidylpeptidaseivaamylaseandaglucosidaseinhibitorypeptidesfromquinoachenopodiumquinoawilldduringinvitrosimulatedgastrointestinaldigestion AT hernandezledesmablanca releaseofdipeptidylpeptidaseivaamylaseandaglucosidaseinhibitorypeptidesfromquinoachenopodiumquinoawilldduringinvitrosimulatedgastrointestinaldigestion |
| _version_ |
1777670567081541632 |